PDB entry 1lmp

View 1lmp on RCSB PDB site
Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-10-25, released 1996-01-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11941 (0-128)
      • conflict (85)
    Domains in SCOPe 2.01: d1lmpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmpA (A:)
    kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
    rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
    rsyvagcgv