PDB entry 1lmp

View 1lmp on RCSB PDB site
Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout
Deposited on 1994-10-25, released 1996-01-01
The last revision prior to the SCOP 1.67 freeze date was dated 1996-01-01, with a file datestamp of 1996-01-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1lmp__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmp_ (-)
  kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
  rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
  rsyvagcgv