PDB entry 1lmn

View 1lmn on RCSB PDB site
Description: the refined crystal structure of lysozyme from the rainbow trout (oncorhynchus mykiss)
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-10-19, released 1995-02-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rainbow trout lysozyme
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11941 (0-128)
      • conflict (85)
    Domains in SCOPe 2.03: d1lmna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmnA (A:)
    kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
    rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
    rsyvagcgv