PDB entry 1lmm

View 1lmm on RCSB PDB site
Description: Solution Structure of Psmalmotoxin 1, the First Characterized Specific Blocker of ASIC1a NA+ channel
Class: toxin
Keywords: ick, toxin
Deposited on 2002-05-02, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Psalmotoxin 1
    Species: Psalmopoeus cambridgei [TaxId:179874]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lmma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmmA (A:)
    edcipkwkgcvnrhgdcceglecwkrrrsfevcvpktpkt