PDB entry 1lml

View 1lml on RCSB PDB site
Description: leishmanolysin
Class: leishmanolysin
Keywords: leishmanolysin, metalloprotease, glycoprotein
Deposited on 1997-03-13, released 1997-09-17
The last revision prior to the SCOP 1.75 freeze date was dated 1997-09-17, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.191
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leishmanolysin
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lmla_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lmlA (A:)
    vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
    lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
    eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
    arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
    aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
    qwpamfcnesedaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvv
    pysdgsctqraseahasllpfnvfsdaarcidgafrpkatdgivksyaglcanvqcdtat
    rtysvqvhgsndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakdggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lmlA (A:)
    vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
    lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
    eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
    arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
    aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
    qwpamfcnaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvvpysd
    gsctqraseahasllpfnvfsdaarcidgafrpkasyaglcanvqcdtatrtysvqvhgs
    ndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakd