PDB entry 1lml

View 1lml on RCSB PDB site
Description: leishmanolysin
Deposited on 1997-03-13, released 1997-09-17
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lml__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1lml_ (-)
    vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
    lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
    eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
    arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
    aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
    qwpamfcnesedaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvv
    pysdgsctqraseahasllpfnvfsdaarcidgafrpkatdgivksyaglcanvqcdtat
    rtysvqvhgsndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lml_ (-)
    vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
    lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
    eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
    arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
    aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
    qwpamfcnaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvvpysd
    gsctqraseahasllpfnvfsdaarcidgafrpkasyaglcanvqcdtatrtysvqvhgs
    ndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakd