PDB entry 1lmk

View 1lmk on RCSB PDB site
Description: the structure of a bivalent diabody
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-08-29, released 1995-03-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-phosphatidylinositol specific phospholipase c diabody
    Species: Mus musculus
    Gene: L5MK16
    Domains in SCOP 1.75: d1lmka1, d1lmka2
  • Chain 'C':
    Compound: anti-phosphatidylinositol specific phospholipase c diabody
    Species: Mus musculus
    Gene: L5MK16
    Domains in SCOP 1.75: d1lmkc1, d1lmkc2
  • Chain 'E':
    Compound: anti-phosphatidylinositol specific phospholipase c diabody
    Species: Mus musculus
    Gene: L5MK16
    Domains in SCOP 1.75: d1lmke1, d1lmke2
  • Chain 'G':
    Compound: anti-phosphatidylinositol specific phospholipase c diabody
    Species: Mus musculus
    Gene: L5MK16
    Domains in SCOP 1.75: d1lmkg1, d1lmkg2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkA (A:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkC (C:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkE (E:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmkG (G:)
    vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
    dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
    sggggsdieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliy
    kvstrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk