PDB entry 1lmi

View 1lmi on RCSB PDB site
Description: 1.5 angstrom resolution crystal structure of a secreted protein from mycobacterium tuberculosis-mpt63
Class: immune system
Keywords: beta-sandwich, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, IMMUNE SYSTEM
Deposited on 2002-05-01, released 2002-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.198
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Immunogenic protein MPT63/MPB63
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: Rv1926c, MPT63
  Database cross-references and differences (RAF-indexed):
  • Uniprot P97155 (1-130)
    • cloning artifact (0)
  Domains in SCOPe 2.06: d1lmia1, d1lmia2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmiA (A:)
  saypitgklgseltmtdtvgqvvlgwkvsdlksstavipgypvagqvweatatvnairgs
  vtpavsqfnartadginyrvlwqaagpdtisgatipqgeqstgkiyfdvtgpsptivamn
  ngmedlliwep