PDB entry 1lmb

View 1lmb on RCSB PDB site
Description: refined 1.8 angstrom crystal structure of the lambda repressor-operator complex
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1991-11-05, released 1991-11-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain '1':
  Compound: DNA (5'-d(*ap*ap*tp*ap*cp*cp*ap*cp*tp*gp*gp*cp*gp*gp*tp*gp*a p*tp*ap*t)-3')
  
• Chain '2':
  Compound: DNA (5'-d(*tp*ap*tp*ap*tp*cp*ap*cp*cp*gp*cp*cp*ap*gp*tp*gp*g p*tp*ap*t)-3')
  
• Chain '3':
  Compound: protein (lambda repressor)
  Species: Enterobacteria phage lambda [TaxId:10710]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03034 (Start-91)
  Domains in SCOPe 2.01: d1lmb3_
• Chain '4':
  Compound: protein (lambda repressor)
  Species: Enterobacteria phage lambda [TaxId:10710]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03034 (0-91)
  Domains in SCOPe 2.01: d1lmb4_
• Heterogens: HOH

PDB Chain Sequences:

• Chain '1':
  No sequence available.
  
  
• Chain '2':
  No sequence available.
  
  
• Chain '3':
  Sequence, based on SEQRES records: (download)
  

  >1lmb3 (3:)
  stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
  naallakilkvsveefspsiareiyemyeavs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1lmb3 (3:)
  pltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaall
  akilkvsveefspsiareiyemyeavs
  

  
  
• Chain '4':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmb4 (4:)
  stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
  naallakilkvsveefspsiareiyemyeavs