PDB entry 1lmb

View 1lmb on RCSB PDB site
Description: refined 1.8 angstrom crystal structure of the lambda repressor-operator complex
Deposited on 1991-11-05, released 1991-11-05
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '3':
    Domains in SCOP 1.71: d1lmb3_
  • Chain '4':
    Domains in SCOP 1.71: d1lmb4_

PDB Chain Sequences:

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1lmb3 (3:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lmb3 (3:)
    pltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaall
    akilkvsveefspsiareiyemyeavs
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmb4 (4:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavs