PDB entry 1lm8

View 1lm8 on RCSB PDB site
Description: Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex
Class: transcription
Keywords: REGULATION, tumor suppressor, oxygen sensing, TRANSCRIPTION
Deposited on 2002-04-30, released 2002-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: elongin b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lm8b_
  • Chain 'C':
    Compound: elongin c
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lm8c_
  • Chain 'H':
    Compound: Hypoxia-inducible factor 1 alpha
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16665 (Start-19)
      • modified residue (8)
  • Chain 'V':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lm8v_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lm8B (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lm8B (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lm8C (C:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lm8C (C:)
    myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'H':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1lm8V (V:)
    meagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyr
    ghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpe
    nyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lm8V (V:)
    rpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlf
    rdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrld
    ivrslyedledhpnvqkdlerltqeriahq