PDB entry 1lm3

View 1lm3 on RCSB PDB site
Description: A Multi-generation Analysis of Cytochrome b562 Redox Variants: Evolutionary Strategies for Modulating Redox Potential Revealed Using a Library Approach
Class: electron transport
Keywords: four helix bundle, cytochrome, heme-binding, ELECTRON TRANSPORT
Deposited on 2002-04-30, released 2002-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cycB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (60)
      • engineered (64)
      • engineered (105)
    Domains in SCOPe 2.07: d1lm3b_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cycB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (60)
      • engineered (64)
      • engineered (105)
    Domains in SCOPe 2.07: d1lm3d_
  • Heterogens: MG, HEM, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lm3B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    irhgydilvgqiddalklanegkvkeaqaaaeqlkttrnayhqkyl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lm3D (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    irhgydilvgqiddalklanegkvkeaqaaaeqlkttrnayhqkyl