PDB entry 1llu

View 1llu on RCSB PDB site
Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate
Deposited on 2002-04-30, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lluA (A:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluA (A:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lluB (B:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluB (B:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lluC (C:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluC (C:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lluD (D:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluD (D:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lluE (E:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluE (E:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lluF (F:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluF (F:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lluG (G:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluG (G:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1lluH (H:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluH (H:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem