PDB entry 1llu

View 1llu on RCSB PDB site
Description: the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate
Class: oxidoreductase
Keywords: Enzyme-coenzyme-substrate complex, proton relay system, NADH, Alcohol Dehydrogenase, OXIDOREDUCTASE
Deposited on 2002-04-30, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1llua1, d1llua2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1llub1, d1llub2
  • Chain 'C':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1lluc1, d1lluc2
  • Chain 'D':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1llud1, d1llud2
  • Chain 'E':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1llue1, d1llue2
  • Chain 'F':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1lluf1, d1lluf2
  • Chain 'G':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1llug1, d1llug2
  • Chain 'H':
    Compound: alcohol dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTD9 (Start-341)
      • see remark 999 (228-229)
    Domains in SCOPe 2.07: d1lluh1, d1lluh2
  • Heterogens: ZN, NAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lluA (A:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluA (A:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lluB (B:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluB (B:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lluC (C:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluC (C:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lluD (D:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluD (D:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lluE (E:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluE (E:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lluF (F:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluF (F:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lluG (G:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluG (G:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1lluH (H:)
    mtlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkpp
    lpfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgy
    svnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgig
    glghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgv
    lvtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqe
    aldfageglvkatihpgklddinqildqmragqiegrivlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lluH (H:)
    tlpqtmkaavvhaygaplrieevkvplpgpgqvlvkieasgvchtdlhaaegdwpvkppl
    pfipghegvgyvaavgsgvtrvkegdrvgipwlytacgccehcltgwetlcesqqntgys
    vnggyaeyvladpnyvgilpknvefaeiapilcagvtvykglkqtnarpgqwvaisgigg
    lghvavqyaramglhvaaididdaklelarklgasltvnarqedpveaiqrdiggahgvl
    vtavsnsafgqaigmarrggtialvglppgdfptpifdvvlkglhiagsivgtradlqea
    ldfageglvkatihpgklddinqildqmragqiegrivlem