PDB entry 1llt

View 1llt on RCSB PDB site
Description: birch pollen allergen bet v 1 mutant e45s
Class: Allergen
Keywords: Allergen, pathogenesis related proteins
Deposited on 2002-04-30, released 2003-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.274
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pollen allergen bet v 1
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered (44)
    Domains in SCOPe 2.06: d1llta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lltA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissvenisgnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn