PDB entry 1llp

View 1llp on RCSB PDB site
Description: lignin peroxidase (isozyme h2) pi 4.15
Class: oxidoreductase
Keywords: heme protein, glyco protein,, oxidoreductase
Deposited on 1995-11-09, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lignin peroxidase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1llpa_
  • Heterogens: NAG, MAN, A2G, CA, OH, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llpA (A:)
    atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
    kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
    pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
    vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
    lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
    fsffppgkshsdieqacaetpfpslvtlpgpatsvaripphka