PDB entry 1llo

View 1llo on RCSB PDB site
Description: hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin
Class: hydrolase
Keywords: chitinase, lysozyme, hydrolase
Deposited on 1995-11-08, released 1996-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.146
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hevamine
    Species: Hevea brasiliensis [TaxId:3981]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lloa_
  • Heterogens: AMI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lloA (A:)
    ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
    sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
    gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
    qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
    peikkspkyggvmlwskfyddkngysssildsv