PDB entry 1llo

View 1llo on RCSB PDB site
Description: hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin
Class: hydrolase
Keywords: chitinase, lysozyme, hydrolase
Deposited on 1995-11-08, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hevamine
    Species: Hevea brasiliensis [TaxId:3981]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lloa_
  • Heterogens: AMI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lloA (A:)
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv