PDB entry 1lli

View 1lli on RCSB PDB site
Description: the crystal structure of a mutant protein with altered but improved hydrophobic core packing
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1994-03-25, released 1994-08-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lambda repressor)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03034 (Start-91)
      • conflict (35)
      • conflict (39)
      • conflict (46)
    Domains in SCOPe 2.01: d1llia_
  • Chain 'B':
    Compound: protein (lambda repressor)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03034 (0-91)
      • conflict (35)
      • conflict (39)
      • conflict (46)
    Domains in SCOPe 2.01: d1llib_
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*tp*ap*cp*cp*ap*cp*tp*gp*gp*cp*gp*gp*tp*gp*a p*tp*ap*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*tp*ap*tp*ap*tp*cp*ap*cp*cp*gp*cp*cp*ap*gp*tp*gp*g p*tp*ap*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lliA (A:)
    stkkkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lliA (A:)
    kkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnaynaa
    llakilkvsveefspsiareiyemyeavs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lliB (B:)
    stkkkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.