PDB entry 1lli

View 1lli on RCSB PDB site
Description: the crystal structure of a mutant protein with altered but improved hydrophobic core packing
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1994-03-25, released 1994-08-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (lambda repressor)
  Species: Enterobacteria phage lambda [TaxId:10710]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03034 (Start-91)
    • conflict (35)
    • conflict (39)
    • conflict (46)
  Domains in SCOPe 2.01: d1llia_
• Chain 'B':
  Compound: protein (lambda repressor)
  Species: Enterobacteria phage lambda [TaxId:10710]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03034 (0-91)
    • conflict (35)
    • conflict (39)
    • conflict (46)
  Domains in SCOPe 2.01: d1llib_
• Chain 'D':
  Compound: DNA (5'-d(*ap*ap*tp*ap*cp*cp*ap*cp*tp*gp*gp*cp*gp*gp*tp*gp*a p*tp*ap*t)-3')
  
• Chain 'E':
  Compound: DNA (5'-d(*tp*ap*tp*ap*tp*cp*ap*cp*cp*gp*cp*cp*ap*gp*tp*gp*g p*tp*ap*t)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1lliA (A:)
  stkkkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnay
  naallakilkvsveefspsiareiyemyeavs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1lliA (A:)
  kkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnaynaa
  llakilkvsveefspsiareiyemyeavs
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lliB (B:)
  stkkkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnay
  naallakilkvsveefspsiareiyemyeavs
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.