PDB entry 1lli

View 1lli on RCSB PDB site
Description: the crystal structure of a mutant protein with altered but improved hydrophobic core packing
Deposited on 1994-03-25, released 1994-08-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1llia_
  • Chain 'B':
    Domains in SCOP 1.71: d1llib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lliA (A:)
    stkkkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lliA (A:)
    kkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnaynaa
    llakilkvsveefspsiareiyemyeavs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lliB (B:)
    stkkkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnay
    naallakilkvsveefspsiareiyemyeavs