PDB entry 1llf

View 1llf on RCSB PDB site
Description: Cholesterol Esterase (Candida Cylindracea) Crystal Structure at 1.4A resolution
Class: hydrolase
Keywords: Candida cylindracea cholesterol esterase, sterol ester acylhydrolase, HYDROLASE
Deposited on 2002-04-28, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.142
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase 3
    Species: Candida cylindracea [TaxId:44322]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1llfa_
  • Chain 'B':
    Compound: Lipase 3
    Species: Candida cylindracea [TaxId:44322]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1llfb_
  • Heterogens: F23, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llfA (A:)
    aptaklangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgslngqkftsygpsc
    mqqnpegtfeenlgktaldlvmqskvfqavlpqsedcltinvvrppgtkaganlpvmlwi
    fgggfeigsptifppaqmvtksvlmgkpiihvavnyrvaswgflagddikaegsgnaglk
    dqrlgmqwvadniagfggdpskvtifgesagsmsvlchliwndgdntykgkplfragimq
    sgamvpsdpvdgtygneiydlfvssagcgsasdklaclrsassdtlldatnntpgflays
    slrlsylprpdgknitddmyklvrdgkyasvpviigdqndegtifglsslnvttnaqara
    yfkqsfihasdaeidtlmaaypqditqgspfdtgifnaitpqfkrisavlgdlafiharr
    yflnhfqggtkysflskqlsglpimgtfhandivwqdyllgsgsviynnafiafatdldp
    ntagllvnwpkytsssqsgnnlmminalglytgkdnfrtagydalmtnpssffv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llfB (B:)
    aptaklangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgslngqkftsygpsc
    mqqnpegtfeenlgktaldlvmqskvfqavlpqsedcltinvvrppgtkaganlpvmlwi
    fgggfeigsptifppaqmvtksvlmgkpiihvavnyrvaswgflagddikaegsgnaglk
    dqrlgmqwvadniagfggdpskvtifgesagsmsvlchliwndgdntykgkplfragimq
    sgamvpsdpvdgtygneiydlfvssagcgsasdklaclrsassdtlldatnntpgflays
    slrlsylprpdgknitddmyklvrdgkyasvpviigdqndegtifglsslnvttnaqara
    yfkqsfihasdaeidtlmaaypqditqgspfdtgifnaitpqfkrisavlgdlafiharr
    yflnhfqggtkysflskqlsglpimgtfhandivwqdyllgsgsviynnafiafatdldp
    ntagllvnwpkytsssqsgnnlmminalglytgkdnfrtagydalmtnpssffv