PDB entry 1lld

View 1lld on RCSB PDB site
Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase(choh (d)-nad (a)), oxidoreductase
Deposited on 1992-06-08, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Bifidobacterium longum [TaxId:1679]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19869 (Start-318)
      • conflict (198)
    Domains in SCOPe 2.07: d1llda1, d1llda2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Bifidobacterium longum [TaxId:1679]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19869 (Start-318)
      • conflict (198)
    Domains in SCOPe 2.07: d1lldb1, d1lldb2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lldA (A:)
    aettvkptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyp
    tvsidgsddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiy
    mlitnpvdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiageh
    gdsevplwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyai
    gmsgvdiieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkel
    aalkrsaetlketaaqfgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lldA (A:)
    ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
    sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
    vdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiagehgdsevp
    lwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyaigmsgvd
    iieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkelaalkrs
    aetlketaaqfgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lldB (B:)
    aettvkptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyp
    tvsidgsddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiy
    mlitnpvdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiageh
    gdsevplwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyai
    gmsgvdiieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkel
    aalkrsaetlketaaqfgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lldB (B:)
    ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
    sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
    vdiathvaqkltglpenqifgsgtnldsarlrfliaqqtgvnvknvhayiagehgdsevp
    lwesatiggvpmsdwtplpghdpldadkreeihqevknaaykiingkgatnyaigmsgvd
    iieavlhdtnrilpvssmlkdfhgisdicmsvptllnrqgvnntintpvsdkelaalkrs
    aetlketaaqfgf