PDB entry 1ll7

View 1ll7 on RCSB PDB site
Description: structure of the e171q mutant of c. immitis chitinase 1
Deposited on 2002-04-26, released 2002-12-18
The last revision prior to the SCOP 1.67 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll7A (A:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgididwqypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll7B (B:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgididwqypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps