PDB entry 1ll3

View 1ll3 on RCSB PDB site
Description: Crystal Structure of Rabbit Muscle Glycogenin
Deposited on 2002-04-26, released 2002-05-15
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-12, with a file datestamp of 2002-06-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ll3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ll3A (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqqfgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll3A (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsemthpqf
    lnvwwdifttsvvpllqqfgl