PDB entry 1ll2

View 1ll2 on RCSB PDB site
Description: crystal structure of rabbit muscle glycogenin complexed with udp- glucose and manganese
Deposited on 2002-04-26, released 2002-05-15
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-12, with a file datestamp of 2002-06-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ll2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ll2A (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll2A (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrthpqflnv
    wwdifttsvvpllqq