PDB entry 1ll0

View 1ll0 on RCSB PDB site
Description: Crystal Structure of Rabbit Muscle Glycogenin
Deposited on 2002-04-26, released 2002-05-15
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-12, with a file datestamp of 2002-06-12.
Experiment type: XRAY
Resolution: 3.43 Å
R-factor: 0.252
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ll0a_
  • Chain 'B':
    Domains in SCOP 1.63: d1ll0b_
  • Chain 'C':
    Domains in SCOP 1.63: d1ll0c_
  • Chain 'D':
    Domains in SCOP 1.63: d1ll0d_
  • Chain 'E':
    Domains in SCOP 1.63: d1ll0e_
  • Chain 'F':
    Domains in SCOP 1.63: d1ll0f_
  • Chain 'G':
    Domains in SCOP 1.63: d1ll0g_
  • Chain 'H':
    Domains in SCOP 1.63: d1ll0h_
  • Chain 'I':
    Domains in SCOP 1.63: d1ll0i_
  • Chain 'J':
    Domains in SCOP 1.63: d1ll0j_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ll0A (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0A (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsdptmthp
    qflnvwwdifttsvvpllqqfglv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ll0B (B:)
    vprgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleiv
    fdevitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddl
    fereelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnsw
    attdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrse
    ghdptmthpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0B (B:)
    vprgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleiv
    fdevitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddl
    fereelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnsw
    attdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsm
    thpqflnvwwdifttsvvpllqqfglv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ll0C (C:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0C (C:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrstmthpqf
    lnvwwdifttsvvpllqqfglv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ll0D (D:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0D (D:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsethpqfl
    nvwwdifttsvvpllqqfglv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ll0E (E:)
    hmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevi
    tvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlferee
    lsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdi
    rkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdpt
    mthpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0E (E:)
    hmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevi
    tvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlferee
    lsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdi
    rkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsethpqf
    lnvwwdifttsvvpllqqfglv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ll0F (F:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0F (F:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsethpqfl
    nvwwdifttsvvpllqqfglv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ll0G (G:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0G (G:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsemthpqf
    lnvwwdifttsvvpllqqfglv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ll0H (H:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
    thpqflnvwwdifttsvvpllqqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0H (H:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsemthpqf
    lnvwwdifttsvvpllqqfg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ll0I (I:)
    rgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfd
    evitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfe
    reelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswat
    tdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsegh
    dptmthpqflnvwwdifttsvvpllqqfglv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0I (I:)
    rgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfd
    evitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfe
    reelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswat
    tdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsehp
    qflnvwwdifttsvvpllqqfglv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ll0J (J:)
    tdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevitv
    dildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereels
    aapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdirk
    hlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptmt
    hpqflnvwwdifttsvvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll0J (J:)
    tdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevitv
    dildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereels
    aapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdirk
    hlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrshpqflnvw
    wdifttsvvpl