PDB entry 1lkz

View 1lkz on RCSB PDB site
Description: crystal structure of d-ribose-5-phosphate isomerase (rpia) from escherichia coli.
Deposited on 2002-04-26, released 2002-05-08
The last revision prior to the SCOP 1.65 freeze date was dated 2002-05-08, with a file datestamp of 2002-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkzA (A:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkzB (B:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk