PDB entry 1lkx

View 1lkx on RCSB PDB site
Description: motor domain of myoe, a class-I myosin
Class: contractile protein
Keywords: myosin motor domain, lever arm, converter domain, contractile protein
Deposited on 2002-04-26, released 2002-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin ie heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03479
      • see remark 999 (25)
      • see remark 999 (47)
      • see remark 999 (76)
      • see remark 999 (136-137)
      • see remark 999 (214)
      • see remark 999 (370-375)
      • see remark 999 (377)
      • see remark 999 (379)
      • see remark 999 (426-428)
      • see remark 999 (439)
      • see remark 999 (497)
      • see remark 999 (603)
      • see remark 999 (680)
      • see remark 999 (682)
    Domains in SCOPe 2.06: d1lkxa_
  • Chain 'B':
    Compound: myosin ie heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03479
      • see remark 999 (25)
      • see remark 999 (47)
      • see remark 999 (76)
      • see remark 999 (136-137)
      • see remark 999 (214)
      • see remark 999 (370-375)
      • see remark 999 (377)
      • see remark 999 (379)
      • see remark 999 (426-428)
      • see remark 999 (439)
      • see remark 999 (497)
      • see remark 999 (603)
      • see remark 999 (680)
      • see remark 999 (682)
    Domains in SCOPe 2.06: d1lkxb_
  • Chain 'C':
    Compound: myosin ie heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03479 (Start-696)
      • see remark 999 (25)
      • see remark 999 (47)
      • see remark 999 (76)
      • see remark 999 (136-137)
      • see remark 999 (214)
      • see remark 999 (370-375)
      • see remark 999 (377)
      • see remark 999 (379)
      • see remark 999 (426-428)
      • see remark 999 (439)
      • see remark 999 (497)
      • see remark 999 (603)
      • see remark 999 (680)
      • see remark 999 (682)
    Domains in SCOPe 2.06: d1lkxc_
  • Chain 'D':
    Compound: myosin ie heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03479
      • see remark 999 (25)
      • see remark 999 (47)
      • see remark 999 (76)
      • see remark 999 (136-137)
      • see remark 999 (214)
      • see remark 999 (370-375)
      • see remark 999 (377)
      • see remark 999 (379)
      • see remark 999 (426-428)
      • see remark 999 (439)
      • see remark 999 (497)
      • see remark 999 (603)
      • see remark 999 (680)
      • see remark 999 (682)
    Domains in SCOPe 2.06: d1lkxd_
  • Heterogens: MG, VO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lkxA (A:)
    mipktkaegvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykes
    dikayngrykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltf
    vssnqspngeriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkit
    nylleksrvvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvsti
    ddsgefkiivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtk
    slaaaasclktdqqslsialcyrsistgvgkrcsvisvpmdcnqaaysrdalakalyerl
    fnwlvskintiincttekgpvigildiygfevfqnnsfeqlninfcneklqqlfieltlk
    seqeeyvregiewknieyfnnkpiceliekkpiglislldeacliakstdqtfldsickq
    feknphlqsyvvskdrsigdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssd
    plvqglfpptrpedskkrpetagsqfrnamnalittllacsphyvrciksndnkqagvid
    edrvrhqvrylgllenvrvrragfagrieytrfynrykmlckktwpsfngtakqatelil
    qqhnidkeeirmgktkvfirnpttlfyfeekrelemp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lkxA (A:)
    gvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykesdikayngr
    ykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltfvssnqspn
    geriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkitnylleksr
    vvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvstiddsgefki
    ivkametlglkesdqnsiwrilaailhignitfaeaaeqttvkvsdtkslaaaasclktd
    qqslsialcyrsvisvpmdcnqaaysrdalakalyerlfnwlvskintiincttekgpvi
    gildiygfevfqnnsfeqlninfcneklqqlfieltlkseqeeyvregiewknieyfnnk
    piceliekkpiglislldeacliakstdqtfldsickqfeknphlqsyvvskdrsigdtc
    frlkhyagdvtydvrgfldknkdtlfgdlissmqsssdplvqglfpetagsqfrnamnal
    ittllacsphyvrciksndnkqagvidedrvrhqvrylgllenvrvrragfagrieytrf
    ynrykmlckkkqatelilqqhnidkeeirmgktkvfirnpttlfyfeekr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lkxB (B:)
    mipktkaegvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykes
    dikayngrykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltf
    vssnqspngeriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkit
    nylleksrvvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvsti
    ddsgefkiivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtk
    slaaaasclktdqqslsialcyrsistgvgkrcsvisvpmdcnqaaysrdalakalyerl
    fnwlvskintiincttekgpvigildiygfevfqnnsfeqlninfcneklqqlfieltlk
    seqeeyvregiewknieyfnnkpiceliekkpiglislldeacliakstdqtfldsickq
    feknphlqsyvvskdrsigdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssd
    plvqglfpptrpedskkrpetagsqfrnamnalittllacsphyvrciksndnkqagvid
    edrvrhqvrylgllenvrvrragfagrieytrfynrykmlckktwpsfngtakqatelil
    qqhnidkeeirmgktkvfirnpttlfyfeekrelemp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lkxB (B:)
    gvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykesdikayngr
    ykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltfvssnqspn
    geriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkitnylleksr
    vvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvstiddsgefki
    ivkametlglkesdqnsiwrilaailhignitfaeaaeqttvkvsdtkslaaaasclktd
    qqslsialcyrsvisvpmdcnqaaysrdalakalyerlfnwlvskintiincttekgpvi
    gildiygfevfqnnsfeqlninfcneklqqlfieltlkseqeeyvregiewknieyfnnk
    piceliekkpiglislldeacliakstdqtfldsickqfeknphlqsyvvskdrsigdtc
    frlkhyagdvtydvrgfldknkdtlfgdlissmqsssdplvqglfpetagsqfrnamnal
    ittllacsphyvrciksndnkqagvidedrvrhqvrylgllenvrvrragfagrieytrf
    ynrykmlckakqatelilqqhnidkeeirmgktkvfirnpttlfyfeekr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lkxC (C:)
    mipktkaegvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykes
    dikayngrykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltf
    vssnqspngeriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkit
    nylleksrvvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvsti
    ddsgefkiivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtk
    slaaaasclktdqqslsialcyrsistgvgkrcsvisvpmdcnqaaysrdalakalyerl
    fnwlvskintiincttekgpvigildiygfevfqnnsfeqlninfcneklqqlfieltlk
    seqeeyvregiewknieyfnnkpiceliekkpiglislldeacliakstdqtfldsickq
    feknphlqsyvvskdrsigdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssd
    plvqglfpptrpedskkrpetagsqfrnamnalittllacsphyvrciksndnkqagvid
    edrvrhqvrylgllenvrvrragfagrieytrfynrykmlckktwpsfngtakqatelil
    qqhnidkeeirmgktkvfirnpttlfyfeekrelemp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lkxC (C:)
    gvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykesdikayngr
    ykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltfvssnqspn
    geriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkitnylleksr
    vvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvstiddsgefki
    ivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtkslaaaasc
    lktdqqslsialcyrsvisvpmdcnqaaysrdalakalyerlfnwlvskintiincttek
    gpvigildiygfevfqnnsfeqlninfcneklqqlfieltlkseqeeyvregiewkniey
    fnnkpiceliekkpiglislldeacliakstdqtfldsickqfeknphlqsyvvskdrsi
    gdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssdplvqglfpptrpedskkr
    petagsqfrnamnalittllacsphyvrciksndnkqagvidedrvrhqvrylgllenvr
    vrragfagrieytrfynrykmlckktwpsfngtakqatelilqqhnidkeeirmgktkvf
    irnpttlfyfeekrelemp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lkxD (D:)
    mipktkaegvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykes
    dikayngrykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltf
    vssnqspngeriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkit
    nylleksrvvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvsti
    ddsgefkiivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtk
    slaaaasclktdqqslsialcyrsistgvgkrcsvisvpmdcnqaaysrdalakalyerl
    fnwlvskintiincttekgpvigildiygfevfqnnsfeqlninfcneklqqlfieltlk
    seqeeyvregiewknieyfnnkpiceliekkpiglislldeacliakstdqtfldsickq
    feknphlqsyvvskdrsigdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssd
    plvqglfpptrpedskkrpetagsqfrnamnalittllacsphyvrciksndnkqagvid
    edrvrhqvrylgllenvrvrragfagrieytrfynrykmlckktwpsfngtakqatelil
    qqhnidkeeirmgktkvfirnpttlfyfeekrelemp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lkxD (D:)
    gvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykesdikayngr
    ykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltfvssnqspn
    geriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkitnylleksr
    vvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvstiddsgefki
    ivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtkslaaaasc
    lktdqqslsialcyrsvisvpmdcnqaaysrdalakalyerlfnwlvskintiincttek
    gpvigildiygfevfqnnsfeqlninfcneklqqlfieltlkseqeeyvregiewkniey
    fnnkpiceliekkpiglislldeacliakstdqtfldsickqfeknphlqsyvvskdrsi
    gdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssdplvqglfpetagsqfrna
    mnalittllacsphyvrciksndnkqagvidedrvrhqvrylgllenvrvrragfagrie
    ytrfynrykmlckktakqatelilqqhnidkeeirmgktkvfirnpttlfyfeekrelem