PDB entry 1lko

View 1lko on RCSB PDB site
Description: Crystal structure of Desulfovibrio vulgaris rubrerythrin all-iron(II) form
Class: electron transport
Keywords: Rubrerythrin, reduced form, diiron, four-helix bundle, rubredoxin-like, ELECTRON TRANSPORT
Deposited on 2002-04-25, released 2002-09-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.183
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rubrerythrin all-iron(II) form
    Species: Desulfovibrio vulgaris [TaxId:881]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lkoa1, d1lkoa2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lkoA (A:)
    mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
    fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
    fasiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahp
    kahfellginw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lkoA (A:)
    kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
    kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
    asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
    ahfellginw