PDB entry 1lkl

View 1lkl on RCSB PDB site
Description: human p56-lck tyrosine kinase sh2 domain in complex with the phosphotyrosyl peptide ac-ptyr-glu-glu-gly (pyeeg peptide)
Deposited on 1995-11-10, released 1996-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1lkla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lklA (A:)
  epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
  irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt