PDB entry 1lkj

View 1lkj on RCSB PDB site
Description: NMR Structure of Apo Calmodulin from Yeast Saccharomyces cerevisiae
Class: metal binding protein
Keywords: yeast calmodulin, saccharomyces cerevisiae, EF-hand, NMR, metal binding protein
Deposited on 2002-04-25, released 2003-04-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1lkja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lkjA (A:)
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae
vddmlrevsdgsgeiniqqfaallsk