PDB entry 1lki

View 1lki on RCSB PDB site
Description: the crystal structure and biological function of leukemia inhibitory factor: implications for receptor binding
Deposited on 1994-12-12, released 1995-03-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1lki__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lki_ (-)
natcairhpchgnlmnqiknqlaqlngsanalfisyytaqgepfpnnveklcapnmtdfp
sfhgngtektklvelyrmvaylsasltnitrdqkvlnptavslqvklnatidvmrgllsn
vlcrlcnkyrvghvdvppvpdhsdkeafqrkklgcqllgtykqvisvvvqaf