PDB entry 1ljy

View 1ljy on RCSB PDB site
Description: crystal structure of a novel regulatory 40 kda mammary gland protein (mgp-40) secreted during involution
Deposited on 2002-04-23, released 2003-03-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.181
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ljyA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdggapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v