PDB entry 1lju

View 1lju on RCSB PDB site
Description: x-ray structure of c15a arsenate reductase from pi258 complexed with arsenite
Class: oxidoreductase
Keywords: ptpase I fold, p-loop, oxidoreductase
Deposited on 2002-04-22, released 2002-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.241
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: arsenate reductase
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: arsC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A006 (0-130)
    • modified residue (9)
    • engineered (14)
  Domains in SCOPe 2.08: d1ljua_
• Heterogens: K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ljuA (A:)
  mdkktiyfictgnsarsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidis
  nhtsdlidndilkqsdlvvtlcsdadnncpilppnvkkehwgfddpagkewsefqrvrde
  iklaiekfklr