PDB entry 1ljn

View 1ljn on RCSB PDB site
Description: Crystal Structure of Tuekey Egg Lysozyme Complex with Di-N-acetylchitobiose at 1.19A Resolution
Class: hydrolase
Keywords: sugar complex, non-productive binding, HYDROLASE
Deposited on 2002-04-22, released 2002-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.104
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ljna_
  • Heterogens: CBS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ljnA (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl