PDB entry 1ljn

View 1ljn on RCSB PDB site
Description: crystal structure of turkey egg lysozyme complex with di-n- acetylchitobiose at 1.19a resolution
Deposited on 2002-04-22, released 2002-06-05
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.104
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1ljna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ljnA (A:)
  kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
  rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
  hawirgcrl