PDB entry 1ljn

View 1ljn on RCSB PDB site
Description:
Deposited on 2002-04-22, released 2002-06-05
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.104
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ljna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ljnA (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl