PDB entry 1lj8

View 1lj8 on RCSB PDB site
Description: Crystal structure of mannitol dehydrogenase in complex with NAD
Class: oxidoreductase
Keywords: oxidoreductase, NAD, long-chain dehydrogenase
Deposited on 2002-04-19, released 2002-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.171
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannitol dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: mtlD
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08355 (0-End)
      • cloning artifact (0)
      • cloning artifact (49)
      • cloning artifact (104)
      • cloning artifact (145)
      • cloning artifact (186)
      • cloning artifact (227)
      • cloning artifact (234)
      • cloning artifact (293)
      • cloning artifact (321)
      • cloning artifact (330)
      • cloning artifact (334)
    Domains in SCOPe 2.08: d1lj8a3, d1lj8a4, d1lj8a5
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lj8A (A:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lj8A (A:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkp