PDB entry 1lix

View 1lix on RCSB PDB site
Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant
Deposited on 2002-04-18, released 2002-09-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-11, with a file datestamp of 2002-09-11.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.245
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lixA (A:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lixB (B:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lixB (B:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivlvtantvdy
    pniviyiddglislvvvtvenggvkgvnlplpglseqdvrdlrfgvehgvdivfasfvrk
    asdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvf
    laqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetak
    gnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaa
    iivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvd
    rrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lixC (C:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lixC (C:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgadlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavr
    aalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmig
    rcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveav
    kmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttg
    rsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgie
    sgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lixD (D:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lixD (D:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilesevelvkg
    sqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpeglvtqv
    enggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraa
    lgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrc
    nlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavkm
    qhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttgrs
    aqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesg
    klrgflrvgdlvivvtgwrpgsgytnimrvlsi