PDB entry 1liu

View 1liu on RCSB PDB site
Description: Human erythrocyte pyruvate kinase
Class: transferase
Keywords: Pyruvate kinase in the active R-state, TRANSFERASE
Deposited on 2002-04-18, released 2002-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2007-11-20, with a file datestamp of 2007-11-16.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.233
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1liua4, d1liua5, d1liua6
  • Chain 'B':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1liub4, d1liub5
  • Chain 'C':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1liuc4, d1liuc5, d1liuc6
  • Chain 'D':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1liud4, d1liud5, d1liud6
  • Heterogens: FBP, PGA, K, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1liuA (A:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1liuA (A:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1liuB (B:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1liuB (B:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivelvkgsqvl
    vtantvwvdypnivrvvpvggriyiddglislvvvtqvenggvlgsrkgvnlpgaqvdlp
    glseqdvrdlrfgvehgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkr
    fdeilevsdgimvargdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkpr
    ptraetsdvanavldgadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfeelr
    raaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrsaqa
    arqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgs
    gytnimrvlsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1liuC (C:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1liuC (C:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1liuD (D:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1liuD (D:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgiesevelvkgs
    qvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpeglvtqve
    nggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraal
    gpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrcn
    lagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavkmq
    haiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttgrsa
    qllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgk
    lrgflrvgdlvivvtgwrpgsgytnimrvlsi