PDB entry 1lis

View 1lis on RCSB PDB site
Description: the crystal structure of a fertilization protein
Class: fertilization protein
Keywords: fertilization protein
Deposited on 1993-06-29, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lisa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lisA (A:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lisA (A:)
    hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa
    nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr
    mrpadvpvkym