PDB entry 1lir

View 1lir on RCSB PDB site
Description: lq2 from leiurus quinquestriatus, nmr, 22 structures
Class: neurotoxin
Keywords: neurotoxin, scorpion, potassium channel blocker, inward rectifier potassium channel
Deposited on 1998-04-02, released 1998-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-28.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lq2
  Species: Leiurus quinquestriatus hebraeus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45628 (1-36)
  Domains in SCOP 1.75: d1lira_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lirA (A:)
  eftqesctasnqcwsickrlhntnrgkcmnkkcrcys