PDB entry 1lio

View 1lio on RCSB PDB site
Description: structure of apo t. gondii adenosine kinase
Class: transferase
Keywords: alpha-beta structure, transferase
Deposited on 2002-04-17, released 2002-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TVW2
      • conflict (125)
      • conflict (149)
      • conflict (239)
      • conflict (326)
    Domains in SCOPe 2.07: d1lioa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lioA (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgtcavlinekertlcthlgacgsfripedwttfasgalifyataytltatpknale
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaad
    ktalstankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyglsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lioA (A:)
    pmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggsa
    lnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavli
    nekertlcthlgacgsfripedwttfasgalifyataytltatpknalevagyahgipna
    iftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvadktalstankeha
    vegatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggflyg
    lsqgktvkqcimcgnacaqdviqhvgfsl