PDB entry 1lil

View 1lil on RCSB PDB site
Description: bence jones protein cle, a lambda III immunoglobulin light-chain dimer
Class: immunoglobulin
Keywords: immunoglobulin, bence jones protein
Deposited on 1996-05-13, released 1997-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda III bence jones protein cle
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01842 (0-209)
      • conflict (2)
      • conflict (8)
      • conflict (17)
      • conflict (23-24)
      • conflict (28)
      • conflict (30)
      • conflict (36)
      • conflict (39)
      • conflict (43)
      • conflict (46)
      • conflict (49-50)
      • conflict (63)
      • conflict (77-78)
      • conflict (87)
      • insertion (91-92)
      • conflict (94)
    Domains in SCOPe 2.03: d1lila1, d1lila2
  • Chain 'B':
    Compound: lambda III bence jones protein cle
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01842 (0-209)
      • conflict (2)
      • conflict (8)
      • conflict (17)
      • conflict (23-24)
      • conflict (28)
      • conflict (30)
      • conflict (36)
      • conflict (39)
      • conflict (43)
      • conflict (46)
      • conflict (49-50)
      • conflict (63)
      • conflict (77-78)
      • conflict (87)
      • insertion (91-92)
      • conflict (94)
    Domains in SCOPe 2.03: d1lilb1, d1lilb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lilA (A:)
    yevtqppslsvspgqtaritcsgeklgdayvcwyqqrpgqspvvviyqdnrrpsgiperf
    sgsssgntatltisgtqtldeadyycqvwdsnasvvfgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lilB (B:)
    yevtqppslsvspgqtaritcsgeklgdayvcwyqqrpgqspvvviyqdnrrpsgiperf
    sgsssgntatltisgtqtldeadyycqvwdsnasvvfgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs