PDB entry 1lij

View 1lij on RCSB PDB site
Description: structure of t. gondii adenosine kinase bound to prodrug 2 7-iodotubercidin and amp-pcp
Class: transferase
Keywords: alpha-beta structure, transferase
Deposited on 2002-04-17, released 2002-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TVW2
      • conflict (125)
      • conflict (149)
      • conflict (152)
      • conflict (241)
      • conflict (245)
      • conflict (326)
    Domains in SCOPe 2.07: d1lija_
  • Heterogens: CL, MG, RPP, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lijA (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgtcavlinekertlcthlgacgsfripenwttfasgalifyataytltatpknale
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaae
    kvalsvankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyglsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lijA (A:)
    gpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggs
    alnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavl
    inekertlcthlgacgsfripenwttfasgalifyataytltatpknalevagyahgipn
    aiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvkvalsvankehav
    tgatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggflygl
    sqgktvkqcimcgnacaqdviqhvgfslsf