PDB entry 1lii

View 1lii on RCSB PDB site
Description: structure of t. gondii adenosine kinase bound to adenosine 2 and amp-pcp
Deposited on 2002-04-17, released 2002-05-15
The last revision prior to the SCOP 1.71 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1liia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1liiA (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgtcavlinekertlcthlgacgsfripenwttfasgalifyataytltatpknale
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaae
    kvalsvankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyglsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1liiA (A:)
    gpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggs
    alnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavl
    inekertlcthlgacgsfripenwttfasgalifyataytltatpknalevagyahgipn
    aiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvakvalsvankeha
    vegatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggflyg
    lsqgktvkqcimcgnacaqdviqhvgfslsf