PDB entry 1lif

View 1lif on RCSB PDB site
Description: the adipocyte lipid-binding protein at 1.6 angstroms resolution: crystal structures of the apoprotein and with bound saturated and unsaturated fatty acids
Class: lipid binding protein
Keywords: lipid-binding protein, lipid binding protein
Deposited on 1993-12-21, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adipocyte lipid-binding protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lifa_
  • Heterogens: STE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lifA (A:)
    cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
    eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
    gvtstrvyera