PDB entry 1li4

View 1li4 on RCSB PDB site
Description: Human S-adenosylhomocysteine hydrolase complexed with neplanocin
Class: hydrolase
Keywords: alpha-beta structure, inhibitor complex, HYDROLASE
Deposited on 2002-04-17, released 2003-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1li4a1, d1li4a2
  • Heterogens: NAD, NOC, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1li4A (A:)
    msdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvet
    avlietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyf
    kdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainv
    ndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvi
    iteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnig
    hfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsn
    sftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgms
    cdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1li4A (A:)
    dklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetav
    lietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyfkd
    gplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmscd
    gpfkpdhyry