PDB entry 1li0

View 1li0 on RCSB PDB site
Description: Crystal structure of TEM-32 beta-Lactamase at 1.6 Angstrom
Class: hydrolase
Keywords: beta-Lactamase, antibiotic resistance, x-ray structure, TEM-32, HYDROLASE
Deposited on 2002-04-17, released 2002-09-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class A beta-Lactamase- TEM-32
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-260)
      • engineered (43)
      • engineered (156)
    Domains in SCOPe 2.01: d1li0a_
  • Heterogens: BCT, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1li0A (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmistfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw