PDB entry 1lhz

View 1lhz on RCSB PDB site
Description: Structure of a Human Bence-Jones Dimer Crystallized in U.S. Space Shuttle Mission STS-95: 293K
Class: immune system
Keywords: Human Bence-Jones Dimer, Microgravity Crystallization, Induced fit, IMMUNE SYSTEM
Deposited on 2002-04-17, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.173
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin lambda light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1LHZ (0-End)
    Domains in SCOPe 2.07: d1lhza1, d1lhza2
  • Chain 'B':
    Compound: immunoglobulin lambda light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1LHZ (0-End)
    Domains in SCOPe 2.07: d1lhzb1, d1lhzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lhzA (A:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lhzA (A:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lhzB (B:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lhzB (B:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt