PDB entry 1lhy

View 1lhy on RCSB PDB site
Description: Crystal structure of TEM-30 beta-Lactamase at 2.0 Angstrom
Class: hydrolase
Keywords: beta-Lactamase, antibiotic resistance, x-ray structure, TEM-30
Deposited on 2002-04-17, released 2002-09-11
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class A beta-Lactamase- TEM 30
    Species: Escherichia coli
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-260)
      • engineered (216)
    Domains in SCOP 1.75: d1lhya_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lhyA (A:)
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergssgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw